HORDB

ID: hor006325
Uniprot ID: Q9BDJ6
Protein name: Ghrelin
Gene name: GHRL
Organism: Bos taurus (Bovine)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0030296 protein tyrosine kinase activator activity; GO:0031768 ghrelin receptor binding
GO BP: GO:0001696 gastric acid secretion; GO:0001937 negative regulation of endothelial cell proliferation; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008154 actin polymerization or depolymerization; GO:0009725 response to hormone; GO:0016358 dendrite development; GO:0032024 positive regulation of insulin secretion; GO:0032095 regulation of response to food; GO:0032097 positive regulation of response to food; GO:0032691 negative regulation of interleukin-1 beta production
GO CC: NA

Sequence: GSSFLSPEHQKLQRKEAKKPSGRLKPR
Length: 27
Propeptide: MPAPWTICSLLLLSVLCMDLAMAGSSFLSPEHQKLQRKEAKKPSGRLKPRTLEGQFDPEVGSQAEGAEDELEIRFNAPFNIGIKLAGAQSLQHGQTLGKFLQDILWEEAEETLANE
Signal peptide: MPAPWTICSLLLLSVLCMDLAMA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Ghrelin]: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation (By similarity).
Mechanism: NA
Cross BBB: NA
Target: GHSR
Target Unid: B5U8Y5
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006325_AF2.pdb

hor006325_ESM.pdb

Mass:	355449	Formula:	C135H229N45O38
Absent amino acids:	CDIMNTVWY	Common amino acids:	K
pI:	11.78	Basic residues:	9
Polar residues:	6	Hydrophobic residues:	5
Hydrophobicity:	-159.26	Boman Index:	-9404
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	47.04
Instability Index:	4122.22	Extinction Coefficient cystines:	0
Absorbance 280nm:	0